Lineage for d4pyla_ (4pyl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611697Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. Protein Catechol O-methyltransferase, COMT [53337] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (7 PDB entries)
  8. 1611714Domain d4pyla_: 4pyl A: [257588]
    automated match to d1vida_
    protein/RNA complex; complexed with mg, sfg, tcw

Details for d4pyla_

PDB Entry: 4pyl (more details), 2.2 Å

PDB Description: Humanized rat COMT in complex with sinefungin, Mg2+, and tolcapone
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d4pyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pyla_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslvl
elgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdli
pqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayv
rgsssfecthyssyleymkvvdglekaiyqgps

SCOPe Domain Coordinates for d4pyla_:

Click to download the PDB-style file with coordinates for d4pyla_.
(The format of our PDB-style files is described here.)

Timeline for d4pyla_: