Lineage for d4py8b_ (4py8 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970166Species Influenza A virus [TaxId:59375] [255946] (2 PDB entries)
  8. 1970168Domain d4py8b_: 4py8 B: [257586]
    Other proteins in same PDB: d4py8a_, d4py8j1, d4py8j2
    automated match to d4n5zb_
    complexed with mli, nag

Details for d4py8b_

PDB Entry: 4py8 (more details), 2.91 Å

PDB Description: Crystal structure of Fab 3.1 in complex with the 1918 influenza virus hemagglutinin
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4py8b_:

Sequence, based on SEQRES records: (download)

>d4py8b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 59375]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei

Sequence, based on observed residues (ATOM records): (download)

>d4py8b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 59375]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlyekv
ksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei

SCOPe Domain Coordinates for d4py8b_:

Click to download the PDB-style file with coordinates for d4py8b_.
(The format of our PDB-style files is described here.)

Timeline for d4py8b_: