Lineage for d4pwna_ (4pwn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673728Protein Protein kinase wnk1 [111196] (1 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 1673729Species Human (Homo sapiens) [TaxId:9606] [111197] (2 PDB entries)
    Uniprot Q9JIH7 211-480
  8. 1673732Domain d4pwna_: 4pwn A: [257581]
    automated match to d3fpqb_
    complexed with po4

Details for d4pwna_

PDB Entry: 4pwn (more details), 1.84 Å

PDB Description: crystal structure of active wnk1 kinase
PDB Compounds: (A:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d4pwna_:

Sequence, based on SEQRES records: (download)

>d4pwna_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlekrasfaksvigtpe
fmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkva
ipevkeiiegcirqnkderysikdllnhaffqee

Sequence, based on observed residues (ATOM records): (download)

>d4pwna_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdfkeeaemlkglqhpn
ivrfydswestcivlvtelmtsgtlktylkrfkvmkikvlrswcrqilkglqflhtrtpp
iihrdlkcdnifitgptgsvkigdlglatlefmapemyeekydesvdvyafgmcmlemat
seypysecqnaaqiyrrvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnha
ffqee

SCOPe Domain Coordinates for d4pwna_:

Click to download the PDB-style file with coordinates for d4pwna_.
(The format of our PDB-style files is described here.)

Timeline for d4pwna_: