Lineage for d4pv9d_ (4pv9 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746544Domain d4pv9d_: 4pv9 D: [257578]
    Other proteins in same PDB: d4pv9a1, d4pv9a2, d4pv9c1, d4pv9c2
    automated match to d1lk2b_
    complexed with act, gol

Details for d4pv9d_

PDB Entry: 4pv9 (more details), 2 Å

PDB Description: crystal structure of h2kb-q600v complex
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d4pv9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv9d_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d4pv9d_:

Click to download the PDB-style file with coordinates for d4pv9d_.
(The format of our PDB-style files is described here.)

Timeline for d4pv9d_: