Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein) PubMed 17876832; C-terminal part of Pfam PF11940 this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain |
Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species) |
Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries) |
Domain d4pw4a4: 4pw4 A:540-867 [257576] Other proteins in same PDB: d4pw4a1, d4pw4a2, d4pw4a3 automated match to d2gtqa4 complexed with 2x0, gol, imd, so4, zn |
PDB Entry: 4pw4 (more details), 1.85 Å
SCOPe Domain Sequences for d4pw4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pw4a4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]} pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn lvkqalqriraqeglskdvgeivgkild
Timeline for d4pw4a4: