Lineage for d4pw4a4 (4pw4 A:540-867)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1501061Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein)
    PubMed 17876832; C-terminal part of Pfam PF11940
    this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain
  6. 1501062Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species)
  7. 1501063Species Neisseria meningitidis [TaxId:122586] [254838] (7 PDB entries)
  8. 1501068Domain d4pw4a4: 4pw4 A:540-867 [257576]
    Other proteins in same PDB: d4pw4a1, d4pw4a2, d4pw4a3
    automated match to d2gtqa4
    complexed with 2x0, gol, imd, so4, zn

Details for d4pw4a4

PDB Entry: 4pw4 (more details), 1.85 Å

PDB Description: crystal structure of aminopeptidase n in complex with phosphonic acid analogue of homophenylalanine l-(r)-hphep
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pw4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pw4a4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkild

SCOPe Domain Coordinates for d4pw4a4:

Click to download the PDB-style file with coordinates for d4pw4a4.
(The format of our PDB-style files is described here.)

Timeline for d4pw4a4: