Lineage for d4pw4a2 (4pw4 A:189-438)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661524Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins)
    adopts thermolysin-like fold
  6. 1661525Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 1661526Species Neisseria meningitidis [TaxId:122586] [254836] (7 PDB entries)
  8. 1661531Domain d4pw4a2: 4pw4 A:189-438 [257574]
    Other proteins in same PDB: d4pw4a1, d4pw4a3, d4pw4a4
    automated match to d2gtqa2
    complexed with 2x0, gol, imd, so4, zn

Details for d4pw4a2

PDB Entry: 4pw4 (more details), 1.85 Å

PDB Description: crystal structure of aminopeptidase n in complex with phosphonic acid analogue of homophenylalanine l-(r)-hphep
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pw4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pw4a2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4pw4a2:

Click to download the PDB-style file with coordinates for d4pw4a2.
(The format of our PDB-style files is described here.)

Timeline for d4pw4a2: