SCOPe 2.07: Domain d4pw4a1: 4pw4 A:3-188

Lineage for d4pw4a1 (4pw4 A:3-188)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)

6. Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries)

8. Domain d4pw4a1: 4pw4 A:3-188 [257573]
   Other proteins in same PDB: d4pw4a2, d4pw4a3, d4pw4a4
   automated match to d2gtqa1
   complexed with 2x0, gol, imd, so4, zn

Details for d4pw4a1

PDB Entry: 4pw4, 1.85 Å

PDB Description: crystal structure of aminopeptidase n in complex with phosphonic acid analogue of homophenylalanine l-(r)-hphep

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pw4a1:

Sequence; same for both SEQRES and ATOM records:

>d4pw4a1 b.98.1.1 (A:3-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]}
ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
falvag

Timeline for d4pw4a1:

• d4pw4a1 first appeared in SCOPe 2.04
  
• d4pw4a1 appears in SCOPe 2.06
  
• d4pw4a1 appears in the current release, SCOPe 2.08