SCOPe 2.07: Domain d4pvba4: 4pvb A:540-867

Lineage for d4pvba4 (4pvb A:540-867)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein)
   PubMed 17876832; C-terminal part of Pfam PF11940
   this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain

6. Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries)

8. Domain d4pvba4: 4pvb A:540-867 [257572]
   Other proteins in same PDB: d4pvba1, d4pvba2, d4pvba3
   automated match to d2gtqa4
   complexed with 2ww, po4, so4, zn

Details for d4pvba4

PDB Entry: 4pvb, 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine (d-(s)-leup)

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pvba4:

Sequence; same for both SEQRES and ATOM records:

>d4pvba4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkild

Timeline for d4pvba4:

• d4pvba4 first appeared in SCOPe 2.04
  
• d4pvba4 appears in SCOPe 2.06
  
• d4pvba4 appears in the current release, SCOPe 2.08