![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein) PubMed 17876832; C-terminal part of Pfam PF11940 this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain |
![]() | Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:122586] [254838] (7 PDB entries) |
![]() | Domain d4pvba4: 4pvb A:540-867 [257572] Other proteins in same PDB: d4pvba1, d4pvba2, d4pvba3 automated match to d2gtqa4 complexed with 2ww, po4, so4, zn |
PDB Entry: 4pvb (more details), 2.1 Å
SCOPe Domain Sequences for d4pvba4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pvba4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]} pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn lvkqalqriraqeglskdvgeivgkild
Timeline for d4pvba4: