![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins) |
![]() | Protein Aminopeptidase N (APN) domain 3 [254401] (1 species) PubMed 17876832; N-terminal part of Pfam PF11940 |
![]() | Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries) |
![]() | Domain d4pvba3: 4pvb A:439-539 [257571] Other proteins in same PDB: d4pvba1, d4pvba2, d4pvba4 automated match to d2gtqa3 complexed with 2ww, po4, so4, zn |
PDB Entry: 4pvb (more details), 2.1 Å
SCOPe Domain Sequences for d4pvba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pvba3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]} agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk rateavlllteaeqtfllegvteavvpsllrgfsapvhlny
Timeline for d4pvba3: