SCOPe 2.06: Domain d4pvba3: 4pvb A:439-539

Lineage for d4pvba3 (4pvb A:439-539)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)

6. Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
   PubMed 17876832; N-terminal part of Pfam PF11940

7. Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)

8. Domain d4pvba3: 4pvb A:439-539 [257571]
   Other proteins in same PDB: d4pvba1, d4pvba2, d4pvba4
   automated match to d2gtqa3
   complexed with 2ww, po4, so4, zn

Details for d4pvba3

PDB Entry: 4pvb, 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine (d-(s)-leup)

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pvba3:

Sequence; same for both SEQRES and ATOM records:

>d4pvba3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

Timeline for d4pvba3:

• d4pvba3 first appeared in SCOPe 2.04
  
• d4pvba3 appears in SCOPe 2.05
  
• d4pvba3 appears in SCOPe 2.07
  
• d4pvba3 appears in the current release, SCOPe 2.08