Lineage for d4pvba2 (4pvb A:189-438)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571313Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2571314Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 2571315Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries)
  8. 2571323Domain d4pvba2: 4pvb A:189-438 [257570]
    Other proteins in same PDB: d4pvba1, d4pvba3, d4pvba4
    automated match to d2gtqa2
    complexed with 2ww, po4, so4, zn

Details for d4pvba2

PDB Entry: 4pvb (more details), 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine (d-(s)-leup)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pvba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pvba2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4pvba2:

Click to download the PDB-style file with coordinates for d4pvba2.
(The format of our PDB-style files is described here.)

Timeline for d4pvba2: