![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
![]() | Protein FMN-binding protein MTH152 [50483] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [50484] (1 PDB entry) |
![]() | Domain d1ejea_: 1eje A: [25757] structural genomics complexed with fmn, ni, so4 |
PDB Entry: 1eje (more details), 2.2 Å
SCOPe Domain Sequences for d1ejea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejea_ b.45.1.2 (A:) FMN-binding protein MTH152 {Methanobacterium thermoautotrophicum [TaxId: 145262]} gsqaahmmsmdfedfpvesahriltprptvmvttvdeegninaapfsftmpvsidppvva fasapdhhtarniesthefvinitpadiiermwvtardipageneleaaglawtssrrvk ppriveapghlecellrmfevgdhnlitgsvvsasvrsgavkeglldvesvkpvlhvggn kfvvgdhvrhve
Timeline for d1ejea_: