Lineage for d4pvba1 (4pvb A:4-188)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085522Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2085523Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2085524Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2085525Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species)
  7. 2085526Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries)
  8. 2085535Domain d4pvba1: 4pvb A:4-188 [257569]
    Other proteins in same PDB: d4pvba2, d4pvba3, d4pvba4
    automated match to d2gtqa1
    complexed with 2ww, po4, so4, zn

Details for d4pvba1

PDB Entry: 4pvb (more details), 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine (d-(s)-leup)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pvba1 b.98.1.1 (A:4-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]}
tvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkin
gaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrk
itfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylf
alvag

SCOPe Domain Coordinates for d4pvba1:

Click to download the PDB-style file with coordinates for d4pvba1.
(The format of our PDB-style files is described here.)

Timeline for d4pvba1: