| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries) Uniprot P01887 |
| Domain d4pv9b_: 4pv9 B: [257568] Other proteins in same PDB: d4pv9a1, d4pv9a2, d4pv9c1, d4pv9c2 automated match to d1lk2b_ complexed with act, gol |
PDB Entry: 4pv9 (more details), 2 Å
SCOPe Domain Sequences for d4pv9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv9b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d4pv9b_: