Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries) Uniprot P01901 22-299 |
Domain d4pv9c1: 4pv9 C:1-181 [257566] Other proteins in same PDB: d4pv9a2, d4pv9b_, d4pv9c2, d4pv9d_ automated match to d1t0ma2 complexed with act, gol |
PDB Entry: 4pv9 (more details), 2 Å
SCOPe Domain Sequences for d4pv9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv9c1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d4pv9c1:
View in 3D Domains from other chains: (mouse over for more information) d4pv9a1, d4pv9a2, d4pv9b_, d4pv9d_ |