SCOPe 2.04: Domain d4pv9c1: 4pv9 C:1-181

Lineage for d4pv9c1 (4pv9 C:1-181)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (43 PDB entries)
   Uniprot P01901 22-299

8. Domain d4pv9c1: 4pv9 C:1-181 [257566]
   Other proteins in same PDB: d4pv9a2, d4pv9b_, d4pv9c2, d4pv9d_
   automated match to d1t0ma2
   complexed with act, gol

Details for d4pv9c1

PDB Entry: 4pv9, 2 Å

PDB Description: crystal structure of h2kb-q600v complex

PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d4pv9c1:

Sequence; same for both SEQRES and ATOM records:

>d4pv9c1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d4pv9c1:

• d4pv9c1 is new in SCOPe 2.04-stable
  
• d4pv9c1 appears in SCOPe 2.05
  
• d4pv9c1 appears in the current release, SCOPe 2.08