SCOPe 2.06: Domain d4pv9a2: 4pv9 A:182-278

Lineage for d4pv9a2 (4pv9 A:182-278)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d4pv9a2: 4pv9 A:182-278 [257565]
   Other proteins in same PDB: d4pv9a1, d4pv9b_, d4pv9c1, d4pv9d_
   automated match to d1t0ma1
   complexed with act, gol

Details for d4pv9a2

PDB Entry: 4pv9, 2 Å

PDB Description: crystal structure of h2kb-q600v complex

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d4pv9a2:

Sequence; same for both SEQRES and ATOM records:

>d4pv9a2 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d4pv9a2:

• d4pv9a2 first appeared in SCOPe 2.04
  
• d4pv9a2 appears in SCOPe 2.05
  
• d4pv9a2 appears in SCOPe 2.07
  
• d4pv9a2 appears in the current release, SCOPe 2.08