Lineage for d4pv9a1 (4pv9 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545171Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2545206Domain d4pv9a1: 4pv9 A:1-181 [257564]
    Other proteins in same PDB: d4pv9a2, d4pv9b_, d4pv9c2, d4pv9d_
    automated match to d1t0ma2
    complexed with act, gol

Details for d4pv9a1

PDB Entry: 4pv9 (more details), 2 Å

PDB Description: crystal structure of h2kb-q600v complex
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d4pv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv9a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d4pv9a1:

Click to download the PDB-style file with coordinates for d4pv9a1.
(The format of our PDB-style files is described here.)

Timeline for d4pv9a1: