SCOPe 2.05: Domain d4pu2a3: 4pu2 A:439-539

Lineage for d4pu2a3 (4pu2 A:439-539)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)

6. Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
   PubMed 17876832; N-terminal part of Pfam PF11940

7. Species Neisseria meningitidis [TaxId:122586] [254837] (8 PDB entries)

8. Domain d4pu2a3: 4pu2 A:439-539 [257557]
   Other proteins in same PDB: d4pu2a1, d4pu2a2, d4pu2a4
   automated match to d2gtqa3
   complexed with gol, plu, so4, zn

Details for d4pu2a3

PDB Entry: 4pu2, 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine l-(r)-leup

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pu2a3:

Sequence; same for both SEQRES and ATOM records:

>d4pu2a3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

Timeline for d4pu2a3:

• d4pu2a3 first appeared in SCOPe 2.04
  
• d4pu2a3 appears in SCOPe 2.06
  
• d4pu2a3 appears in the current release, SCOPe 2.08