Lineage for d4pu2a3 (4pu2 A:439-539)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766974Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2766975Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 2766976Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)
  8. 2766984Domain d4pu2a3: 4pu2 A:439-539 [257557]
    Other proteins in same PDB: d4pu2a1, d4pu2a2, d4pu2a4
    automated match to d2gtqa3
    complexed with gol, plu, so4, zn

Details for d4pu2a3

PDB Entry: 4pu2 (more details), 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine l-(r)-leup
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pu2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pu2a3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d4pu2a3:

Click to download the PDB-style file with coordinates for d4pu2a3.
(The format of our PDB-style files is described here.)

Timeline for d4pu2a3: