Lineage for d4pu2a2 (4pu2 A:189-438)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206010Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2206011Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 2206012Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries)
  8. 2206019Domain d4pu2a2: 4pu2 A:189-438 [257556]
    Other proteins in same PDB: d4pu2a1, d4pu2a3, d4pu2a4
    automated match to d2gtqa2
    complexed with gol, plu, so4, zn

Details for d4pu2a2

PDB Entry: 4pu2 (more details), 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine l-(r)-leup
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pu2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pu2a2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4pu2a2:

Click to download the PDB-style file with coordinates for d4pu2a2.
(The format of our PDB-style files is described here.)

Timeline for d4pu2a2: