SCOPe 2.05: Domain d4pu2a2: 4pu2 A:189-438

Lineage for d4pu2a2 (4pu2 A:189-438)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254836] (8 PDB entries)

8. Domain d4pu2a2: 4pu2 A:189-438 [257556]
   Other proteins in same PDB: d4pu2a1, d4pu2a3, d4pu2a4
   automated match to d2gtqa2
   complexed with gol, plu, so4, zn

Details for d4pu2a2

PDB Entry: 4pu2, 2.1 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphonic acid analogue of leucine l-(r)-leup

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4pu2a2:

Sequence; same for both SEQRES and ATOM records:

>d4pu2a2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

Timeline for d4pu2a2:

• d4pu2a2 first appeared in SCOPe 2.04
  
• d4pu2a2 appears in SCOPe 2.06
  
• d4pu2a2 appears in the current release, SCOPe 2.08