SCOPe 2.07: Domain d4pt4a_: 4pt4 A:

Lineage for d4pt4a_ (4pt4 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (9 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries)

8. Domain d4pt4a_: 4pt4 A: [257547]
   automated match to d3c4ia_
   complexed with fmt

Details for d4pt4a_

PDB Entry: 4pt4, 2.04 Å

PDB Description: crystal structure analysis of n terminal region containing the dimerization domain and dna binding domain of hu protein(histone like protein-dna binding) from mycobacterium tuberculosis [h37rv]

PDB Compounds: (A:) DNA-binding protein HU homolog

SCOPe Domain Sequences for d4pt4a_:

Sequence; same for both SEQRES and ATOM records:

>d4pt4a_ a.55.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg

Timeline for d4pt4a_:

• d4pt4a_ first appeared in SCOPe 2.04
  
• d4pt4a_ appears in SCOPe 2.06