| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
| Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
| Protein automated matches [191007] (11 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries) |
| Domain d4pt4a_: 4pt4 A: [257547] automated match to d3c4ia_ complexed with fmt |
PDB Entry: 4pt4 (more details), 2.04 Å
SCOPe Domain Sequences for d4pt4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pt4a_ a.55.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg
Timeline for d4pt4a_: