Lineage for d4pt4a_ (4pt4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715225Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries)
  8. 2715228Domain d4pt4a_: 4pt4 A: [257547]
    automated match to d3c4ia_
    complexed with fmt

Details for d4pt4a_

PDB Entry: 4pt4 (more details), 2.04 Å

PDB Description: crystal structure analysis of n terminal region containing the dimerization domain and dna binding domain of hu protein(histone like protein-dna binding) from mycobacterium tuberculosis [h37rv]
PDB Compounds: (A:) DNA-binding protein HU homolog

SCOPe Domain Sequences for d4pt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pt4a_ a.55.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva
rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpaeg

SCOPe Domain Coordinates for d4pt4a_:

Click to download the PDB-style file with coordinates for d4pt4a_.
(The format of our PDB-style files is described here.)

Timeline for d4pt4a_: