![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
![]() | Protein automated matches [191007] (11 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [188755] (3 PDB entries) |
![]() | Domain d4pt4b_: 4pt4 B: [257546] automated match to d3c4ia_ complexed with fmt |
PDB Entry: 4pt4 (more details), 2.04 Å
SCOPe Domain Sequences for d4pt4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pt4b_ a.55.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mnkaelidvltqklgsdrrqataavenvvdtivravhkgdsvtitgfgvfeqrrraarva rnprtgetvkvkptsvpafrpgaqfkavvsgaqrlpa
Timeline for d4pt4b_: