Lineage for d1g77a_ (1g77 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794219Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 2794223Species Escherichia coli [TaxId:562] [50481] (7 PDB entries)
    Uniprot P28225
  8. 2794227Domain d1g77a_: 1g77 A: [25754]
    complexed with fmn, plp, po4
    has additional insertions and/or extensions that are not grouped together

Details for d1g77a_

PDB Entry: 1g77 (more details), 2.1 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5`-phosphate oxidase complexed with pyridoxal 5'-phosphate at 2.0 a resolution
PDB Compounds: (A:) pyridoxine 5`-phosphate oxidase

SCOPe Domain Sequences for d1g77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g77a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap

SCOPe Domain Coordinates for d1g77a_:

Click to download the PDB-style file with coordinates for d1g77a_.
(The format of our PDB-style files is described here.)

Timeline for d1g77a_: