Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries) |
Domain d4ps7a3: 4ps7 A:525-725 [257537] Other proteins in same PDB: d4ps7a1, d4ps7a2, d4ps7a4 automated match to d1e8ya1 complexed with 2wj |
PDB Entry: 4ps7 (more details), 2.69 Å
SCOPe Domain Sequences for d4ps7a3:
Sequence, based on SEQRES records: (download)
>d4ps7a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d4ps7a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea ylrgcg
Timeline for d4ps7a3: