SCOPe 2.06: Domain d1dnla_: 1dnl A:

Lineage for d1dnla_ (1dnl A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Escherichia coli [TaxId:562] [50481] (7 PDB entries)
   Uniprot P28225

8. Domain d1dnla_: 1dnl A: [25753]
   complexed with fmn, po4

Details for d1dnla_

PDB Entry: 1dnl, 1.8 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution

PDB Compounds: (A:) pyridoxine 5'-phosphate oxidase

SCOPe Domain Sequences for d1dnla_:

Sequence; same for both SEQRES and ATOM records:

>d1dnla_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap

Timeline for d1dnla_:

• d1dnla_ first appeared (with stable ids) in SCOP 1.55
  
• d1dnla_ appears in SCOPe 2.05
  
• d1dnla_ appears in SCOPe 2.07
  
• d1dnla_ appears in the current release, SCOPe 2.08