Lineage for d1dnla_ (1dnl A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230244Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 230245Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 230246Family b.45.1.1: PNP-oxidase like [50476] (2 proteins)
  6. 230252Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (3 species)
    elaborated with additional secondary structures; active as dimer
  7. 230256Species Escherichia coli [TaxId:562] [50481] (6 PDB entries)
  8. 230257Domain d1dnla_: 1dnl A: [25753]

Details for d1dnla_

PDB Entry: 1dnl (more details), 1.8 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution

SCOP Domain Sequences for d1dnla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnla_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli}
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap

SCOP Domain Coordinates for d1dnla_:

Click to download the PDB-style file with coordinates for d1dnla_.
(The format of our PDB-style files is described here.)

Timeline for d1dnla_: