SCOPe 2.04: Domain d4pqua2: 4pqu A:430-545

Lineage for d4pqua2 (4pqu A:430-545)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (15 PDB entries)

8. Domain d4pqua2: 4pqu A:430-545 [257525]
   Other proteins in same PDB: d4pqua1, d4pqub_, d4pqud_
   automated match to d2ykna2
   protein/DNA complex; protein/RNA complex; complexed with dtp, edo, gol, mg, so4

Details for d4pqua2

PDB Entry: 4pqu, 2.51 Å

PDB Description: Crystal structure of HIV-1 Reverse Transcriptase in complex with RNA/DNA and dATP

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4pqua2:

Sequence; same for both SEQRES and ATOM records:

>d4pqua2 c.55.3.0 (A:430-545) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggn

Timeline for d4pqua2:

• d4pqua2 is new in SCOPe 2.04-stable
  
• d4pqua2 appears in SCOPe 2.05
  
• d4pqua2 appears in the current release, SCOPe 2.08