Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (5 species) not a true protein |
Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries) |
Domain d4pqua1: 4pqu A:1-429 [257524] Other proteins in same PDB: d4pqua2, d4pqub_, d4pquc2, d4pqud_ automated match to d2ykna1 protein/DNA complex; protein/RNA complex; complexed with dtp, edo, gol, mg, so4 |
PDB Entry: 4pqu (more details), 2.51 Å
SCOPe Domain Sequences for d4pqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pqua1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d4pqua1:
View in 3D Domains from other chains: (mouse over for more information) d4pqub_, d4pquc1, d4pquc2, d4pqud_ |