SCOPe 2.05: Domain d4pqua1: 4pqu A:1-429

Lineage for d4pqua1 (4pqu A:1-429)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)

8. Domain d4pqua1: 4pqu A:1-429 [257524]
   Other proteins in same PDB: d4pqua2, d4pqub_, d4pquc2, d4pqud_
   automated match to d2ykna1
   protein/DNA complex; protein/RNA complex; complexed with dtp, edo, gol, mg, so4

Details for d4pqua1

PDB Entry: 4pqu, 2.51 Å

PDB Description: Crystal structure of HIV-1 Reverse Transcriptase in complex with RNA/DNA and dATP

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4pqua1:

Sequence; same for both SEQRES and ATOM records:

>d4pqua1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4pqua1:

• d4pqua1 first appeared in SCOPe 2.04
  
• d4pqua1 appears in SCOPe 2.06
  
• d4pqua1 appears in the current release, SCOPe 2.08