Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species) elaborated with additional secondary structures; active as dimer |
Species Escherichia coli [TaxId:562] [50481] (7 PDB entries) Uniprot P28225 |
Domain d1g79a_: 1g79 A: [25752] complexed with bme, fmn, plp, po4 |
PDB Entry: 1g79 (more details), 2 Å
SCOPe Domain Sequences for d1g79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g79a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]} gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh drflyqrendawkidrlap
Timeline for d1g79a_: