Lineage for d4po0a2 (4po0 A:197-388)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343957Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries)
  8. 2343971Domain d4po0a2: 4po0 A:197-388 [257519]
    automated match to d3uiva1
    complexed with nps

Details for d4po0a2

PDB Entry: 4po0 (more details), 2.73 Å

PDB Description: Crystal Structure of Leporine Serum Albumin in complex with naproxen
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4po0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4po0a2 a.126.1.0 (A:197-388) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rlrcasiqkfgdraykawalvrlsqrfpkadftdiskivtdltkvhkecchgdllecadd
radlakymcehqetisshlkeccdkpilekahciyglhndetpaglpavaeefvedkdvc
knyeeakdlflgkflyeysrrhpdysvvlllrlgkayeatlkkccatddphacyakvlde
fqplvdepknlv

SCOPe Domain Coordinates for d4po0a2:

Click to download the PDB-style file with coordinates for d4po0a2.
(The format of our PDB-style files is described here.)

Timeline for d4po0a2: