Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (3 PDB entries) |
Domain d4po0a1: 4po0 A:2-196 [257518] automated match to d3uiva1 complexed with nps |
PDB Entry: 4po0 (more details), 2.73 Å
SCOPe Domain Sequences for d4po0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4po0a1 a.126.1.0 (A:2-196) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ahkseiahrfndvgeehfiglvlitfsqylqkcpyeehaklvkevtdlakacvadesaan cdkslhdifgdkicalpslrdtygdvadccekkepernecflhhkddkpdlppfarpead vlckafhddekaffghylyevarrhpyfyapellyyaqkykailtecceaadkgacltpk ldalkekalisaaqe
Timeline for d4po0a1: