SCOPe 2.04: Domain d4picb_: 4pic B:

Lineage for d4picb_ (4pic B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (13 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [257509] (1 PDB entry)

8. Domain d4picb_: 4pic B: [257511]
   automated match to d3js5a_
   complexed with po4, so4

Details for d4picb_

PDB Entry: 4pic, 1.4 Å

PDB Description: ywle arginine phosphatase from geobacillus stearothermophilus

PDB Compounds: (B:) Arginine phosphatase Ywle

SCOPe Domain Sequences for d4picb_:

Sequence; same for both SEQRES and ATOM records:

>d4picb_ c.44.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
pyrilfvctgntcrspmaaallenkqlpgvevksagvfaaegseasvhakmvlkekgiea
ahrssqlkkehidwathvlamtsghkdmiverfpeakdktftlkqfvsgtdgdiadpfgg
pievyraardeletlidrlaeklqteqlehhhhh

Timeline for d4picb_:

• d4picb_ is new in SCOPe 2.04-stable
  
• d4picb_ appears in SCOPe 2.05
  
• d4picb_ appears in the current release, SCOPe 2.08, called d4picb1