SCOPe 2.05: Domain d4pica_: 4pic A:

Lineage for d4pica_ (4pic A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (15 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [257509] (1 PDB entry)

8. Domain d4pica_: 4pic A: [257510]
   automated match to d3js5a_
   complexed with po4, so4

Details for d4pica_

PDB Entry: 4pic, 1.4 Å

PDB Description: ywle arginine phosphatase from geobacillus stearothermophilus

PDB Compounds: (A:) Arginine phosphatase Ywle

SCOPe Domain Sequences for d4pica_:

Sequence; same for both SEQRES and ATOM records:

>d4pica_ c.44.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
pyrilfvctgntcrspmaaallenkqlpgvevksagvfaaegseasvhakmvlkekgiea
ahrssqlkkehidwathvlamtsghkdmiverfpeakdktftlkqfvsgtdgdiadpfgg
pievyraardeletlidrlaeklqteqlehhhhh

Timeline for d4pica_:

• d4pica_ first appeared in SCOPe 2.04
  
• d4pica_ is called d4pica1 in SCOPe 2.06
  
• d4pica_ appears in the current release, SCOPe 2.08, called d4pica1