Lineage for d4pica1 (4pic A:1-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874943Species Geobacillus stearothermophilus [TaxId:1422] [257509] (1 PDB entry)
  8. 2874944Domain d4pica1: 4pic A:1-147 [257510]
    Other proteins in same PDB: d4pica2, d4picb2
    automated match to d3js5a_
    complexed with po4, so4

Details for d4pica1

PDB Entry: 4pic (more details), 1.4 Å

PDB Description: ywle arginine phosphatase from geobacillus stearothermophilus
PDB Compounds: (A:) Arginine phosphatase Ywle

SCOPe Domain Sequences for d4pica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pica1 c.44.1.0 (A:1-147) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
pyrilfvctgntcrspmaaallenkqlpgvevksagvfaaegseasvhakmvlkekgiea
ahrssqlkkehidwathvlamtsghkdmiverfpeakdktftlkqfvsgtdgdiadpfgg
pievyraardeletlidrlaeklqteq

SCOPe Domain Coordinates for d4pica1:

Click to download the PDB-style file with coordinates for d4pica1.
(The format of our PDB-style files is described here.)

Timeline for d4pica1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pica2