SCOP 1.61: Domain d1ci0b_: 1ci0 B:

Lineage for d1ci0b_ (1ci0 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.45: FMN-binding split barrel [50474] (1 superfamily)

4. Superfamily b.45.1: FMN-binding split barrel [50475] (2 families)

5. Family b.45.1.1: PNP-oxidase like [50476] (2 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50480] (1 PDB entry)

8. Domain d1ci0b_: 1ci0 B: [25751]

Details for d1ci0b_

PDB Entry: 1ci0, 2.7 Å

PDB Description: pnp oxidase from saccharomyces cerevisiae

SCOP Domain Sequences for d1ci0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ci0b_ b.45.1.1 (B:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae)}
tlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhrg
ftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprgs
kigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrps
rlhdrfvyrrktendpwkvvrlap

Timeline for d1ci0b_:

• d1ci0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ci0b_ appears in SCOP 1.59
  
• d1ci0b_ appears in SCOP 1.63
  
• d1ci0b_ appears in the current release, SCOPe 2.08