SCOPe 2.08: Domain d4pf4a1: 4pf4 A:1-277

Lineage for d4pf4a1 (4pf4 A:1-277)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Death-associated protein kinase, Dap [75560] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
   Uniprot P53355 2-285

8. Domain d4pf4a1: 4pf4 A:1-277 [257506]
   Other proteins in same PDB: d4pf4a2
   automated match to d2yaka_
   complexed with gol, mg, na, so4

Details for d4pf4a1

PDB Entry: 4pf4, 1.13 Å

PDB Description: 1.1a x-ray structure of the apo catalytic domain of death-associated protein kinase 1, aa 1-277

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d4pf4a1:

Sequence; same for both SEQRES and ATOM records:

>d4pf4a1 d.144.1.7 (A:1-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
fsntsalakdfirrllvkdpkkrmtiqdslqhpwikp

Timeline for d4pf4a1:

• d4pf4a1 first appeared in SCOPe 2.04, called d4pf4a_
  
• d4pf4a1 appears in SCOPe 2.07