Lineage for d4pfsa_ (4pfs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114506Species Mycobacterium smegmatis [TaxId:246196] [189426] (5 PDB entries)
  8. 2114507Domain d4pfsa_: 4pfs A: [257505]
    automated match to d1wcv1_

Details for d4pfsa_

PDB Entry: 4pfs (more details), 2.3 Å

PDB Description: crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis
PDB Compounds: (A:) Cobyrinic Acid a,c-diamide synthase

SCOPe Domain Sequences for d4pfsa_:

Sequence, based on SEQRES records: (download)

>d4pfsa_ c.37.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsv
hevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdv
viidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllga
lptlydsrtthsrdvlldvadryelpvlappiprtvrfaeasasgssvlagrkskgaiay
refadallrhwksgrkmptftpe

Sequence, based on observed residues (ATOM records): (download)

>d4pfsa_ c.37.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mtrvlavanqkgaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsvhe
vllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdvvi
idcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllgalp
tlydsrtthsrdvlldvadryelpvlappiprtrkskgaiayrefadallrhwksgrkmp
tftpe

SCOPe Domain Coordinates for d4pfsa_:

Click to download the PDB-style file with coordinates for d4pfsa_.
(The format of our PDB-style files is described here.)

Timeline for d4pfsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4pfsb_