Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (140 species) not a true protein |
Species Marinobacter aquaeolei [TaxId:351348] [257503] (1 PDB entry) |
Domain d4pfia_: 4pfi A: [257504] automated match to d2wx9a_ complexed with na |
PDB Entry: 4pfi (more details), 2.3 Å
SCOPe Domain Sequences for d4pfia_:
Sequence, based on SEQRES records: (download)
>d4pfia_ c.94.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]} vtwrfaleeiegsvqhlyaqqfreqvealsggrievdvfpygslgtsaqlteltrngsvn lafaspghladtvpetglfnlhfllpeeqeparrlleapafisafepayhnaglqllgfv pegwmtwtannplrtpsdfqglrfrtmtsetaaeafrsygadpvqtpfaqvysdlqlgni dgqsnpvfaieemgfhevqnvltmarasrfiasvvanedwfaglpsqerkwleetiaqls eeawtlqedlnkerletileqggirvvrltederaafrdaslparqrfieltgekgqali qrats
>d4pfia_ c.94.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]} vtwrfaleeiegsvqhlyaqqfreqvealsggrievdvfpygslaqlteltrngsvnlaf aspghladtvpetglfnlhfllpeeqeparrlleapafisafepayhnaglqllgfvpeg wmtwtannplrtpsdfqglrfrtmtsetaaeafrsygadpvqtpfaqvysdlqlgnidgq snpvfaieemgfhevqnvltmarasrfiasvvanedwfaglpsqerkwleetiaqlseea wtlqedlnkerletileqggirvvrltederaafrdaslparqrfieltgekgqaliqra ts
Timeline for d4pfia_: