Lineage for d4pfia_ (4pfi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145882Species Marinobacter aquaeolei [TaxId:351348] [257503] (1 PDB entry)
  8. 2145883Domain d4pfia_: 4pfi A: [257504]
    automated match to d2wx9a_
    complexed with na

Details for d4pfia_

PDB Entry: 4pfi (more details), 2.3 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from marinobacter aquaeolei vt8 (maqu_2829, target efi-510133), apo open structure
PDB Compounds: (A:) TRAP dicarboxylate transporter-DctP subunit

SCOPe Domain Sequences for d4pfia_:

Sequence, based on SEQRES records: (download)

>d4pfia_ c.94.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}
vtwrfaleeiegsvqhlyaqqfreqvealsggrievdvfpygslgtsaqlteltrngsvn
lafaspghladtvpetglfnlhfllpeeqeparrlleapafisafepayhnaglqllgfv
pegwmtwtannplrtpsdfqglrfrtmtsetaaeafrsygadpvqtpfaqvysdlqlgni
dgqsnpvfaieemgfhevqnvltmarasrfiasvvanedwfaglpsqerkwleetiaqls
eeawtlqedlnkerletileqggirvvrltederaafrdaslparqrfieltgekgqali
qrats

Sequence, based on observed residues (ATOM records): (download)

>d4pfia_ c.94.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]}
vtwrfaleeiegsvqhlyaqqfreqvealsggrievdvfpygslaqlteltrngsvnlaf
aspghladtvpetglfnlhfllpeeqeparrlleapafisafepayhnaglqllgfvpeg
wmtwtannplrtpsdfqglrfrtmtsetaaeafrsygadpvqtpfaqvysdlqlgnidgq
snpvfaieemgfhevqnvltmarasrfiasvvanedwfaglpsqerkwleetiaqlseea
wtlqedlnkerletileqggirvvrltederaafrdaslparqrfieltgekgqaliqra
ts

SCOPe Domain Coordinates for d4pfia_:

Click to download the PDB-style file with coordinates for d4pfia_.
(The format of our PDB-style files is described here.)

Timeline for d4pfia_: