Lineage for d4pfba_ (4pfb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915545Species Fusobacterium nucleatum [TaxId:190304] [257501] (2 PDB entries)
  8. 2915547Domain d4pfba_: 4pfb A: [257502]
    automated match to d4n6ka_
    complexed with g3p, imd, zn

Details for d4pfba_

PDB Entry: 4pfb (more details), 2.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from fusobacterium nucleatun (fn1258, target efi-510120) with bound sn- glycerol-3-phosphate
PDB Compounds: (A:) C4-dicarboxylate-binding protein

SCOPe Domain Sequences for d4pfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfba_ c.94.1.0 (A:) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
arvikvttkfvddeqtakslvkvveainqrsngtlelqlftsgtlpigkdgmeqvangsd
wilvdgvnflgdyvpdynavtgpmlyqsfeeylrmvktplvqdlnaqalekgikvlsldw
lfgfrnieakkpiktpedmkglklrvptsqlytftieamggnpvampypdtyaalqqgvi
dglegsilsfygtkqyenvkeysltrhllgvsavciskkcwdsltdeqrtiiqeefdkga
ldnltetekledeyaqklkdngvtfhevdaeafnkavapvydkfpkwtpgiydkimenlt
qiredikn

SCOPe Domain Coordinates for d4pfba_:

Click to download the PDB-style file with coordinates for d4pfba_.
(The format of our PDB-style files is described here.)

Timeline for d4pfba_: