SCOPe 2.04: Domain d4perb_: 4per B:

Lineage for d4perb_ (4per B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (5 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [257499] (1 PDB entry)

8. Domain d4perb_: 4per B: [257500]
   Other proteins in same PDB: d4pera_
   automated match to d2zpoa_

Details for d4perb_

PDB Entry: 4per, 1.92 Å

PDB Description: structure of gallus gallus ribonuclease inhibitor complexed with gallus gallus ribonuclease i

PDB Compounds: (B:) angiogenin

SCOPe Domain Sequences for d4perb_:

Sequence, based on SEQRES records:

>d4perb_ d.5.1.0 (B:) automated matches {Gallus gallus [TaxId: 9031]}
ptyqdflrthvdfpktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntlcin
qpnralrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt

Sequence, based on observed residues (ATOM records):

>d4perb_ d.5.1.0 (B:) automated matches {Gallus gallus [TaxId: 9031]}
ptyqdflrthvdktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntinqpnr
alrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt

Timeline for d4perb_:

• d4perb_ is new in SCOPe 2.04-stable
  
• d4perb_ appears in SCOPe 2.05
  
• d4perb_ appears in the current release, SCOPe 2.08