Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (5 species) not a true protein |
Species Gallus gallus [TaxId:9031] [257499] (1 PDB entry) |
Domain d4perb_: 4per B: [257500] Other proteins in same PDB: d4pera_ automated match to d2zpoa_ |
PDB Entry: 4per (more details), 1.92 Å
SCOPe Domain Sequences for d4perb_:
Sequence, based on SEQRES records: (download)
>d4perb_ d.5.1.0 (B:) automated matches {Gallus gallus [TaxId: 9031]} ptyqdflrthvdfpktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntlcin qpnralrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt
>d4perb_ d.5.1.0 (B:) automated matches {Gallus gallus [TaxId: 9031]} ptyqdflrthvdktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntinqpnr alrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt
Timeline for d4perb_: