SCOPe 2.05: Domain d1ci0a_: 1ci0 A:

Lineage for d1ci0a_ (1ci0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50480] (1 PDB entry)

8. Domain d1ci0a_: 1ci0 A: [25750]
   complexed with fmn

Details for d1ci0a_

PDB Entry: 1ci0, 2.7 Å

PDB Description: pnp oxidase from saccharomyces cerevisiae

PDB Compounds: (A:) protein (pnp oxidase)

SCOPe Domain Sequences for d1ci0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhr
gftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprg
skigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrp
srlhdrfvyrrktendpwkvvrlap

Timeline for d1ci0a_:

• d1ci0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ci0a_ appears in SCOPe 2.04
  
• d1ci0a_ appears in SCOPe 2.06
  
• d1ci0a_ appears in the current release, SCOPe 2.08