Lineage for d1ci0a_ (1ci0 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298628Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 298629Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 298630Family b.45.1.1: PNP-oxidase like [50476] (2 proteins)
  6. 298636Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (3 species)
    elaborated with additional secondary structures; active as dimer
  7. 298637Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50480] (1 PDB entry)
  8. 298638Domain d1ci0a_: 1ci0 A: [25750]

Details for d1ci0a_

PDB Entry: 1ci0 (more details), 2.7 Å

PDB Description: pnp oxidase from saccharomyces cerevisiae

SCOP Domain Sequences for d1ci0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae)}
ftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhr
gftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprg
skigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrp
srlhdrfvyrrktendpwkvvrlap

SCOP Domain Coordinates for d1ci0a_:

Click to download the PDB-style file with coordinates for d1ci0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ci0a_: