![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.45: FMN-binding split barrel [50474] (1 superfamily) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (2 proteins) |
![]() | Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (3 species) elaborated with additional secondary structures; active as dimer |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50480] (1 PDB entry) |
![]() | Domain d1ci0a_: 1ci0 A: [25750] |
PDB Entry: 1ci0 (more details), 2.7 Å
SCOP Domain Sequences for d1ci0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae)} ftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhr gftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprg skigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrp srlhdrfvyrrktendpwkvvrlap
Timeline for d1ci0a_: