Lineage for d1ci0a_ (1ci0 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.45: FMN-binding split barrel [50474] (1 superfamily) Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) 
Family b.45.1.1: PNP-oxidase like [50476] (2 proteins) 
Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (2 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50480] (1 PDB entry) 
Domain d1ci0a_: 1ci0 A: [25750]
Details for d1ci0a_
PDB Entry: 1ci0 (more details), 2.7 Å
PDB Description: pnp oxidase from saccharomyces cerevisiae
SCOP Domain Sequences for d1ci0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci0a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Baker's yeast (Saccharomyces cerevisiae)}
ftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgrvssrillfkeldhr
gftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfktrprg
skigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrp
srlhdrfvyrrktendpwkvvrlap
SCOP Domain Coordinates for d1ci0a_:
Click to download the PDB-style file with coordinates for d1ci0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ci0a_:
- d1ci0a_ appears in SCOP 1.57
- d1ci0a_ appears in the current release, SCOPe 2.08
View in 3D
