Lineage for d4pera1 (4per A:1-456)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098543Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2098603Family c.10.1.0: automated matches [257495] (1 protein)
    not a true family
  6. 2098604Protein automated matches [257496] (2 species)
    not a true protein
  7. 2098605Species Chicken (Gallus gallus) [TaxId:9031] [257497] (1 PDB entry)
  8. 2098606Domain d4pera1: 4per A:1-456 [257498]
    Other proteins in same PDB: d4pera2, d4perb_
    automated match to d3tsre_

Details for d4pera1

PDB Entry: 4per (more details), 1.92 Å

PDB Description: structure of gallus gallus ribonuclease inhibitor complexed with gallus gallus ribonuclease i
PDB Compounds: (A:) ribonuclease inhibitor

SCOPe Domain Sequences for d4pera1:

Sequence, based on SEQRES records: (download)

>d4pera1 c.10.1.0 (A:1-456) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkelklnn
nelgdagieylckglltpscslqklwlqncnltsascetlrsvlsaqpsltelhvgdnkl
gtagvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnntlgdt
avkqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigdtgla
llcqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgmemlc
qalkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveilcegl
lhpncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklceavrnp
nckmqqlilydifwgpevddelkaleearpdvkiis

Sequence, based on observed residues (ATOM records): (download)

>d4pera1 c.10.1.0 (A:1-456) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkelklnn
nelgdagieylckglltpslqklwlqncnltsascetlrsvlsaqpsltelhvgdnklgt
agvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnntlgdtav
kqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigdtglall
cqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgmemlcqa
lkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveilcegllh
pncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklceavrnpnc
kmqqlilydifwgpevddelkaleearpdvkiis

SCOPe Domain Coordinates for d4pera1:

Click to download the PDB-style file with coordinates for d4pera1.
(The format of our PDB-style files is described here.)

Timeline for d4pera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pera2
View in 3D
Domains from other chains:
(mouse over for more information)
d4perb_